PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016470141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 327aa    MW: 35008.1 Da    PI: 9.4271
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016470141.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822219.66.8e-68281592133
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqs 96 
                     +++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+++++ +e++g+sa+++p+ss + 
  XP_016470141.1  28 SGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCSRPTPMEIGGTSANITPSSSRHP 122
                     799******************************************************************************************** PP

          DUF822  97 slkssalaspvesysaspksssfpspssldsislasa 133
                     s+ ss++asp++sy++sp+sssfpsps+ d ++++++
  XP_016470141.1 123 SPPSSYFASPIPSYQPSPTSSSFPSPSRGDANMSSHP 159
                     ******************************9988754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.4E-6128157IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMWEGGGSPA TSSAGGGGAG GAMGSSSSGR RKPSWREREN NRRRERRRRA IAAKIYAGLR  60
AQGNYNLPKH CDNNEVLKAL CAEAGWIVEP DGTTYRKGCS RPTPMEIGGT SANITPSSSR  120
HPSPPSSYFA SPIPSYQPSP TSSSFPSPSR GDANMSSHPF AFLHSSIPSS LPPLRISNSA  180
PVTPPLSSPT RLPKQTFNLE TLARESMSAL NIPFFAASAP TSPTRGQRFT PATIPECDES  240
DSSTIDSGQW MSFQKYATNG VPTSPTFNLI KPAAQRIPSN DMIIDKGKSV EFDFENVSVK  300
AAWEGEKIHE VGLDDLELTL GSGSGRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12948RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2474440.0KP247444.1 Nicotiana benthamiana BES1/BZR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781919.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
RefseqXP_016470141.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-114BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB20.0A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.23e-93BES1 family protein